<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25393
Description |
Uncharacterized protein |
Sequence | MGLGKRRHLAGPHAYDRQRLRDTMHSETILEKIIAQTQHVVLRLRVISVRCGPQSGIEVSVSSSPQQQDFYPSTLVRDRKWHNLSGSFREVCLARMQGRSFLSKMEHLMAALTT |
Length | 114 |
Position | Head |
Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.416 |
Instability index | 71.86 |
Isoelectric point | 10.53 |
Molecular weight | 13027.92 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP25393
No repeats found
No repeats found
|