<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25392
| Description |
"Mediator of RNA polymerase II transcription subunit, putative" |
| Sequence | MADRLTQLQDAVNAQADNFCNSIGILQQFAQPSNFPEFEKSLTKPGQSTQEDYPQLFASLVARTAKDIDVLIDSLPSEEASPELQAANLRRLELENQDAARRLEDVVQQGEALLEQIQQALHDIAESQLNMQHLEDVSN |
| Length | 139 |
| Position | Middle |
| Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.527 |
| Instability index | 60.30 |
| Isoelectric point | 4.20 |
| Molecular weight | 15518.94 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25392
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 63.23| 15| 15| 28| 42| 1
---------------------------------------------------------------------------
14- 26 (16.67/ 8.23) ..AQAD..NFCNSIGIL
28- 42 (26.65/16.75) QFAQPS..NFPEFEKSL
44- 60 (19.92/11.01) KPGQSTqeDYPQLFASL
---------------------------------------------------------------------------
|