<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25388
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MSGREVIANLDKVLLHLETKEFSVEPLILQSLQQLTQWVADLTLHLMASLPQQVYNHMRFPGGGLIADPKSLNMLRELLVIFRMWGFISESCLPAYTKMTDECCLLPSQILIPSIDLGNHAEGVASPALFLNSLPLPFEFGIQPDFLHIPSKLHAVEGSVAMPSKVDIVRHIGLGSNPSAARHCTRCFSISMVRPGVKAGTIRAWEQRWVRFCPCGGQWRLVM |
| Length | 223 |
| Position | Tail |
| Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | 0.197 |
| Instability index | 54.38 |
| Isoelectric point | 7.66 |
| Molecular weight | 24855.96 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25388
No repeats found
|