<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25386
Description |
"Mediator of RNA polymerase II transcription subunit, putative" |
Sequence | MVGDQRRPYPTDIEMRQGYLGRLSDLPLSGPPLQQQGNLGDLSAARGHHDQNPLGQSFSWQIGGDIKPPMSSNHNSVGMDTKAKENEDVEVMSTDSSSSSSSDSQ |
Length | 105 |
Position | Middle |
Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.950 |
Instability index | 64.12 |
Isoelectric point | 4.73 |
Molecular weight | 11344.20 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP25386
No repeats found
|