<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25382
| Description |
"Mediator of RNA polymerase II transcription subunit, putative" |
| Sequence | MASSSQIVDDFENSFQACLAAVTNPDYFYVRDSEEVKTGVEQTIQRFLDVAKQMECFFLQKRLVLSAQKPEQIVMEDNTELKNELARKEQLLQKYHEKIHFWQSLLNDTNNAPGPPQQQPQMQQQPQLQQQLQQQQPLQQPPQPGNPQVMQPGAPMQQGMPMNGTVQGLPGPLAYLERTTSNIGMPDSRR |
| Length | 190 |
| Position | Head |
| Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.819 |
| Instability index | 71.83 |
| Isoelectric point | 5.04 |
| Molecular weight | 21680.25 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25382
No repeats found
|