<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25382
Description |
"Mediator of RNA polymerase II transcription subunit, putative" |
Sequence | MASSSQIVDDFENSFQACLAAVTNPDYFYVRDSEEVKTGVEQTIQRFLDVAKQMECFFLQKRLVLSAQKPEQIVMEDNTELKNELARKEQLLQKYHEKIHFWQSLLNDTNNAPGPPQQQPQMQQQPQLQQQLQQQQPLQQPPQPGNPQVMQPGAPMQQGMPMNGTVQGLPGPLAYLERTTSNIGMPDSRR |
Length | 190 |
Position | Head |
Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.819 |
Instability index | 71.83 |
Isoelectric point | 5.04 |
Molecular weight | 21680.25 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP25382
No repeats found
|