<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25381
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MCNYEVGHAIKCTCQAGTGSAHSLLGLQCPGFASMSKSFPGFRWWTLVLRARAVASGVRFRTMARPASEECPLGISWHDTAWIQALEPGNVMDYFSERSNPFYDRTCNNEIVKMQRLSADQLSQMTGLEYILLHAQEPILYVVRKQHRHSPSQVTPLADYYVLAGVVYQAPDLGAVLNSRLLATAHRLQAALDESLSFARYHPFRGYWWQFPDGRPQPKPPAKHAPGSIFQRRRVDLLLAELAANFPPKQHEEAAKQETPAPRPEPSQAKSARGEKRPRLA |
| Length | 281 |
| Position | Head |
| Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.424 |
| Instability index | 53.10 |
| Isoelectric point | 9.37 |
| Molecular weight | 31563.68 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25381
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.98| 11| 161| 34| 45| 1
---------------------------------------------------------------------------
34- 45 (21.66/16.60) SMSKSFPgFR..WW
197- 209 (22.32/11.79) SFARYHP.FRgyWW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.61| 14| 15| 241| 254| 2
---------------------------------------------------------------------------
241- 254 (25.80/11.97) ELAANFP.PKQHEEA
258- 272 (21.81/ 9.19) ETPAPRPePSQAKSA
---------------------------------------------------------------------------
|