<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25380
| Description |
"Mediator of rna polymerase ii transcription subunit 14, putative" |
| Sequence | MAGRGLRPGIVPSPLPLSACGACGEQGYVASPNPSFASLASPPVPGPPPSSSGVVGGAANPHVSPSLLHMQAQSPGNLFGASSPVNPLHAPSPSFLPSPSPSQVPLPSPAQPGFMASQGLGGGSTRVLPQRSWAAAMPTLLSHKGLDLACQSSMGSGMGGPPLPLQLAPHCSPLERFLGCVFMRKSLHRVVQGEENLTMIQTQEPGVIQFRAETLQCRVSLNPASMQSLHLKLSPPGPPEQWSPDELQLLERYFDTKVVSFPYKPNAFMSFTRLLNAPLNILKDFVQLMRLELVSLLSFLWKFLLKG |
| Length | 307 |
| Position | Tail |
| Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.003 |
| Instability index | 71.83 |
| Isoelectric point | 9.17 |
| Molecular weight | 32532.41 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25380
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 184.43| 49| 65| 28| 78| 1
---------------------------------------------------------------------------
11- 43 (51.17/11.83) VPSPlPL......SACGACGeqG..........................................YVASPNPSFASLASPP
44- 102 (87.46/25.45) VPGP.PP......SSSGVVG..GAAN..PHVS.....PSL.....LHMQAQSP.GnlfgasspvnPLHAPSPSFLPSPSPS
104- 162 (45.80/10.05) VPLP.SPaqpgfmASQGLGG..GSTRvlPQRSwaaamPTLlshkgLDLACQSSmG...................SGMGGPP
---------------------------------------------------------------------------
|