| Description | "Mediator of RNA polymerase II transcription subunit, putative" |
| Sequence | MEYRELFENIIAPRSQRLTSSEHAQLAELLVAKDEELKQTLVVGDQRRPYPTDIEMRQGYLGRLSDLPLSGPPLQQQGNLGDLSAARGHHDQNPLGQSFSWQIGGDIKPPMSSNHNSVGMDTKAKENEDVEVMSTDSSSKQTHTLIRPLYCRSN |
| Length | 154 |
| Position | Middle |
| Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari> Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.790 |
| Instability index | 56.27 |
| Isoelectric point | 5.50 |
| Molecular weight | 17229.01 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
| Binary Interactions |
| Repeats | >MDP25379 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) MEYRE 2) SFSWQIGGDIK 3) TDIEMRQGYLGRLSDLPL 4) THTLIRPLYCRS | 1 98 52 142 | 5 108 69 153 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab