Description | "Mediator of RNA polymerase II transcription subunit, putative" |
Sequence | MEYRELFENIIAPRSQRLTSSEHAQLAELLVAKDEELKQTLVVGDQRRPYPTDIEMRQGYLGRLSDLPLSGPPLQQQGNLGDLSAARGHHDQNPLGQSFSWQIGGDIKPPMSSNHNSVGMDTKAKENEDVEVMSTDSSSKQTHTLIRPLYCRSN |
Length | 154 |
Position | Middle |
Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari> Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.790 |
Instability index | 56.27 |
Isoelectric point | 5.50 |
Molecular weight | 17229.01 |
Publications |
Annotated function |
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP25379 No repeats found |
MoRF Sequence | Start | Stop |
1) MEYRE 2) SFSWQIGGDIK 3) TDIEMRQGYLGRLSDLPL 4) THTLIRPLYCRS | 1 98 52 142 | 5 108 69 153 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab