<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25379
| Description |
"Mediator of RNA polymerase II transcription subunit, putative" |
| Sequence | MEYRELFENIIAPRSQRLTSSEHAQLAELLVAKDEELKQTLVVGDQRRPYPTDIEMRQGYLGRLSDLPLSGPPLQQQGNLGDLSAARGHHDQNPLGQSFSWQIGGDIKPPMSSNHNSVGMDTKAKENEDVEVMSTDSSSKQTHTLIRPLYCRSN |
| Length | 154 |
| Position | Middle |
| Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.790 |
| Instability index | 56.27 |
| Isoelectric point | 5.50 |
| Molecular weight | 17229.01 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25379
No repeats found
|