<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25378
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MADVVRRTDQYSPKSSPRGSRSPVVSRQDTTGTLKTTISLGKTPAIVHSGPFYLMKEPPKSELTGATNLMVSYGLEHSYNKFSGRKVKDQLSAFLPNLPGNIDAPGDQDNSSLRSLIEKPPVGGKELLALSGAQLVGFRLHPGPLPEQYRMMSQQPQRKKHKHKKHKHKMGDTPNHESQQQENASDASHEKKHKKQKRHDEEKERKKKKKEKKKKKKHSPEATPANPGNPALPNGAQRVM |
| Length | 240 |
| Position | Head |
| Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.229 |
| Instability index | 59.17 |
| Isoelectric point | 10.10 |
| Molecular weight | 26807.24 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25378
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.24| 14| 45| 13| 26| 1
---------------------------------------------------------------------------
13- 26 (25.80/13.19) PKSSPRGSRSPVVS
59- 72 (24.44/12.18) PKSELTGATNLMVS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.21| 14| 16| 189| 202| 3
---------------------------------------------------------------------------
189- 202 (25.46/13.12) HEKKHKKQKRHDEE
208- 221 (23.75/11.78) KKKEKKKKKKHSPE
---------------------------------------------------------------------------
|