<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25375
| Description |
Expressed protein |
| Sequence | MDSDDKKFGKGPRELTGAVDLISHYKLLAHHDFFCKKPLPLAISDTHYLDNVVGDTEIRKGEGMELDQLVQNAYLRDKPAYIQPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKLKSESKDKEKKHKKHKDKDRDKDKEHKKHKHRHKDRSKDKDKDKDKDKKKDKSGHHDSGGDHSKKHHEKKRKHEGMEDSADVHKHKKSKHKSSRTDDTGNGLS |
| Length | 220 |
| Position | Head |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.565 |
| Instability index | 27.77 |
| Isoelectric point | 9.32 |
| Molecular weight | 25245.02 |
| Publications | PubMed=16188032
PubMed=16100779
PubMed=23299411
PubMed=24280374
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25375
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.85| 11| 16| 49| 59| 5
---------------------------------------------------------------------------
49- 59 (18.36/14.65) LDNVVGDTEIR
66- 76 (18.49/14.80) LDQLVQNAYLR
---------------------------------------------------------------------------
|