Description | Mediator of RNA polymerase II transcription subunit 32 |
Sequence | MEATVDHLSAAYDDFMAAAAAVVEARVQSGGEKKTAATDAALEAFKQRWEIFRVACDHAEELVESIRQRIGSECLVDEATGSASAGSVAAPGIKPISAVRLEQMSKAVRWLVIELQHGASAQGTGGSGGAATPNAGAGGQHPEEGAQ |
Length | 147 |
Position | Tail |
Organism | Zea mays (Maize) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.145 |
Instability index | 48.54 |
Isoelectric point | 4.92 |
Molecular weight | 15074.56 |
Publications | PubMed=18937034 PubMed=19936069 PubMed=19965430 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro leaf senescence GO:0010150 IEA:InterPro regulation of transcription, DNA-templated GO:0006355 IEA:InterPro root development GO:0048364 IEA:InterPro |
Binary Interactions |
Repeats | >MDP25366 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 51.26| 17| 18| 32| 48| 1 --------------------------------------------------------------------------- 32- 48 (27.42/17.14) EKKTAATDAA...LEAFKQR 50- 69 (23.84/14.03) EIFRVACDHAeelVESIRQR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GGAATPNAGAGGQHPEEGAQ 2) KPISAVRL | 128 94 | 147 101 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab