| Description | Mediator of RNA polymerase II transcription subunit 32 |
| Sequence | MEATVDHLSAAYDDFMAAAAAVVEARVQSGGEKKTAATDAALEAFKQRWEIFRVACDHAEELVESIRQRIGSECLVDEATGSASAGSVAAPGIKPISAVRLEQMSKAVRWLVIELQHGASAQGTGGSGGAATPNAGAGGQHPEEGAQ |
| Length | 147 |
| Position | Tail |
| Organism | Zea mays (Maize) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.145 |
| Instability index | 48.54 |
| Isoelectric point | 4.92 |
| Molecular weight | 15074.56 |
| Publications | PubMed=18937034 PubMed=19936069 PubMed=19965430 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro leaf senescence GO:0010150 IEA:InterPro regulation of transcription, DNA-templated GO:0006355 IEA:InterPro root development GO:0048364 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP25366
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.26| 17| 18| 32| 48| 1
---------------------------------------------------------------------------
32- 48 (27.42/17.14) EKKTAATDAA...LEAFKQR
50- 69 (23.84/14.03) EIFRVACDHAeelVESIRQR
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) GGAATPNAGAGGQHPEEGAQ 2) KPISAVRL | 128 94 | 147 101 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab