Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDSLPLAGNLFPSSFSVSNLKANRSPGISENLYPHTPTSPPLMSVGAQNYASNFAHTHTSPSHTTTSNGQPLSSPPSSTPMSTQNSQQPTVSVTTSFPTPASSVSGHPRNTTPADDSELADKSWGQGVQNSHATGNTDLGNVDKSGYRRTDHDRHRLPEGFDTEGRPQAADVDMMDIDSKEDNSSIRDSSLDALQQDIGMAFHLCKSVPTITGPDPSFDLISLYGLGPIGRSVMRADPTTGEKINRLRKSYEGKLKGLGLSGRNKAVKNENQAGGLRHLMMWPEEEWQIQKVHGKEIKVAEAESALQKLQMRAMKLEAGPLPNSEYWEDILGHEKSSKHTNVESGKRAVSTPNTLRPTVQTNGVPPTAAAPERARHTRGKKRHYDDNSFVGYGEGFVDDDDEGALYSNSEDRSGKKKRKKEHISKMSPMPERTGSYGIGMYGIGAR |
Length | 447 |
Position | Head |
Organism | Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) (Penicillium marneffei) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Trichocomaceae> Talaromyces> Talaromyces sect. Talaromyces. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.863 |
Instability index | 45.12 |
Isoelectric point | 6.99 |
Molecular weight | 48579.19 |
Publications | PubMed=25676766 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP25360 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 158.26| 36| 37| 42| 77| 2 --------------------------------------------------------------------------- 42- 77 (65.39/35.95) PLMSVGAQNYASNFAHTHTS.PSHTTTSNGQPLSSPP 81- 114 (49.49/25.42) P.MS..TQNSQQPTVSVTTSfPTPASSVSGHPRNTTP 139- 168 (43.38/21.37) DLGNVDKSGYRRTDHDRHRL.PEGFDT.EGRP..... --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 77.19| 25| 26| 189| 214| 3 --------------------------------------------------------------------------- 189- 214 (40.64/30.01) DSSLDALQ.QDIG.MAFHLCKSVPTiTG 216- 242 (36.54/22.10) DPSFDLISlYGLGpIGRSVMRADPT.TG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 73.83| 22| 37| 284| 305| 5 --------------------------------------------------------------------------- 284- 305 (38.38/33.21) PEEE.WQIQKVHGKEIKVAEAES 323- 345 (35.45/30.03) PNSEyWEDILGHEKSSKHTNVES --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) RKKEHISKMS 2) RTGSYGIGMYGIGAR | 419 433 | 428 447 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab