<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25360

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMSDSLPLAGNLFPSSFSVSNLKANRSPGISENLYPHTPTSPPLMSVGAQNYASNFAHTHTSPSHTTTSNGQPLSSPPSSTPMSTQNSQQPTVSVTTSFPTPASSVSGHPRNTTPADDSELADKSWGQGVQNSHATGNTDLGNVDKSGYRRTDHDRHRLPEGFDTEGRPQAADVDMMDIDSKEDNSSIRDSSLDALQQDIGMAFHLCKSVPTITGPDPSFDLISLYGLGPIGRSVMRADPTTGEKINRLRKSYEGKLKGLGLSGRNKAVKNENQAGGLRHLMMWPEEEWQIQKVHGKEIKVAEAESALQKLQMRAMKLEAGPLPNSEYWEDILGHEKSSKHTNVESGKRAVSTPNTLRPTVQTNGVPPTAAAPERARHTRGKKRHYDDNSFVGYGEGFVDDDDEGALYSNSEDRSGKKKRKKEHISKMSPMPERTGSYGIGMYGIGAR
Length447
PositionHead
OrganismTalaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) (Penicillium marneffei)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Trichocomaceae> Talaromyces> Talaromyces sect. Talaromyces.
Aromaticity0.05
Grand average of hydropathy-0.863
Instability index45.12
Isoelectric point6.99
Molecular weight48579.19
Publications
PubMed=25676766

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP25360
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     158.26|      36|      37|      42|      77|       2
---------------------------------------------------------------------------
   42-   77 (65.39/35.95)	PLMSVGAQNYASNFAHTHTS.PSHTTTSNGQPLSSPP
   81-  114 (49.49/25.42)	P.MS..TQNSQQPTVSVTTSfPTPASSVSGHPRNTTP
  139-  168 (43.38/21.37)	DLGNVDKSGYRRTDHDRHRL.PEGFDT.EGRP.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.19|      25|      26|     189|     214|       3
---------------------------------------------------------------------------
  189-  214 (40.64/30.01)	DSSLDALQ.QDIG.MAFHLCKSVPTiTG
  216-  242 (36.54/22.10)	DPSFDLISlYGLGpIGRSVMRADPT.TG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.83|      22|      37|     284|     305|       5
---------------------------------------------------------------------------
  284-  305 (38.38/33.21)	PEEE.WQIQKVHGKEIKVAEAES
  323-  345 (35.45/30.03)	PNSEyWEDILGHEKSSKHTNVES
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP25360 with Med19 domain of Kingdom Fungi

Unable to open file!