<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25341
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MEALPGTTLLGYKIPDEKTRFEIELEFVQMLSNPWYLNYLAQHKFFEDETFLAYLEYLDYWREPEYTKFLIYPSCLYMLSLLKNPRFREDISRADLSKQLNDELYFDWLHKGEAVNYGKIGDPDSVPVDEK |
| Length | 131 |
| Position | Middle |
| Organism | Schizosaccharomyces japonicus (strain yFS275 / FY16936) (Fission yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina>
Schizosaccharomycetes> Schizosaccharomycetales> Schizosaccharomycetaceae>
Schizosaccharomyces.
|
| Aromaticity | 0.17 |
| Grand average of hydropathy | -0.496 |
| Instability index | 34.21 |
| Isoelectric point | 4.60 |
| Molecular weight | 15725.66 |
| Publications | PubMed=21511999
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | DNA repair GO:0006281 IEA:EnsemblFungi
meiotic gene conversion GO:0006311 IEA:EnsemblFungi
meiotic sister chromatid segregation GO:0045144 IEA:EnsemblFungi
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP25341
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.29| 16| 16| 36| 51| 1
---------------------------------------------------------------------------
36- 51 (30.06/14.68) YLNYLAQHKFFEDETF
54- 69 (32.23/16.12) YLEYLDYWREPEYTKF
---------------------------------------------------------------------------
|