<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25340
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MPVHGLLHCSHVSMATFLAVAQDRLLKQHHAQFLRKWNVHYKLYRNAISPKVLEFLYQNTQPNMMASINNEEAVVDTETDLEAIIVRTKLWTFRQHLCAEGAIYEVGDFVIGVANLLQKTTWKGFLVHVVFKGSDDMSIAQPIIRDLCESCFFRDPTVPVHESYYISEQQYASPKTLQSLFKQRNTMERNSSTTSLHASANVPPMVPAPTAEIPSGSTTDASSAAAAAAAVASNMQQGLHPAAPNSAAAAAYKTEFPMILTNTDSFVDLTNM |
Length | 272 |
Position | Head |
Organism | Schizosaccharomyces japonicus (strain yFS275 / FY16936) (Fission yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina>
Schizosaccharomycetes> Schizosaccharomycetales> Schizosaccharomycetaceae>
Schizosaccharomyces.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.106 |
Instability index | 40.72 |
Isoelectric point | 6.24 |
Molecular weight | 30058.90 |
Publications | PubMed=21511999
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP25340
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 90.75| 21| 21| 208| 228| 1
---------------------------------------------------------------------------
186- 203 (23.55/11.21) ..TMERNS.STTSLHASANVP
208- 228 (34.09/18.97) APTAEIPSGSTTDASSAAAAA
230- 250 (33.11/18.26) AVASNMQQGLHPAAPNSAAAA
---------------------------------------------------------------------------
|