<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25335

Description Mediator of RNA polymerase II transcription subunit 7
SequenceMDSPKLQLFSAFPPPPSYYKLFTEENRKKAFPETKTEDMKVDEEETDEVKQLRHVFTKPDYPKEGTYMMFGDNWQTKIVFPSLEEFGIPQFYKKLDDGAGNAIRLSEQNPLLPKVKEDEGDSAEASTAKKEPSPSDDKVKMEEDETEDKTSLSTTTAESTTTQPVIAHIADELKRLSRSLMLNFLELLGIMAKAPDQFPTKTENMRVILLNIHHLINEYRPHQARESLIVLLEKQLSSIQNNCDDLRQKNETLKSTLDKYKALDVADTEITSFVHSCTDFPPLPDTINHVNAQDEIEAQSAKTKLQRQTLAVEVMKNSAEDITSN
Length325
PositionMiddle
OrganismSchizosaccharomyces japonicus (strain yFS275 / FY16936) (Fission yeast)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina> Schizosaccharomycetes> Schizosaccharomycetales> Schizosaccharomycetaceae> Schizosaccharomyces.
Aromaticity0.06
Grand average of hydropathy-0.731
Instability index53.96
Isoelectric point4.91
Molecular weight36971.18
Publications
PubMed=21511999

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. 
ECO:0000256	RuleBase:RU364060
GO - Cellular Component
euchromatin	GO:0000791	IEA:EnsemblFungi
mediator complex	GO:0016592	IEA:EnsemblFungi
GO - Biological Function
transcription coactivator activity	GO:0003713	IEA:EnsemblFungi
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP25335
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.38|      23|      23|      97|     119|       1
---------------------------------------------------------------------------
   97-  119 (40.06/28.20)	DGAGNAIRLSEQNPLLPKVK..EDE
  121-  145 (34.32/23.09)	DSAEASTAKKEPSPSDDKVKmeEDE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.59|      10|     165|      31|      41|       2
---------------------------------------------------------------------------
   31-   41 (16.47/13.49)	FPeTKTEDMKV
  198-  207 (21.12/12.26)	FP.TKTENMRV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.84|      16|      27|     180|     197|       3
---------------------------------------------------------------------------
  180-  197 (22.58/20.89)	LMLNFLELlgIMAKAPDQ
  208-  223 (28.26/18.43)	ILLNIHHL..INEYRPHQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25335 with Med7 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) AIRLSEQNPLLPKVKEDEGDSAEASTAKKEPSPSDDKVKMEEDETEDKTSLSTTTAESTTTQP
102
164










Molecular Recognition Features






MoRF SequenceStartStop




1) MDSPKLQLFSAFPPPPSYYKLFTEENRKKAFPE
1
33