<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25333

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMVKDGIALLNYDVIEFPEVVFYKVYVIESPGNDIDLERLLEFESRLKGNKVLNYINDENVYTFFLRQEDQKHYEASIYTPIAGIHETNNGFLKTSHFFFTEKIIDDDADAQLFNHFIFAIHKFLIFEACRSYGFISISDYLIPLRLRHHSENQLWTINGYPLICPSTSVIPNGTFYTFFRSSKYRVYKIGSLNAWKESEQKEVILAPFGIRAFLQSPFAKPNPFVASLIAKCSGLVISPSVRWVRLRSTQSMNEYSWPLDLCFALKSMIAESDSPIDTTGDGDPFLESLEMSHEIQRQINLGKVPDTPSETVPLNVPSNSHVTFKESLENKTEVADTQNFFDLVTEPDITDADFDYFDTPTNADTVTPIAYWQDIIENEDMNHRSTQSKFNVPSGPTGTTRTEHYSGDYGSEKSTSVTSSFPLRETSPGKFSFMSSNYRGEALSPKMKTLNAKYAAGGKYWCPYNEVSSESVIHLDPSVSEQFAEPTFTVPSDSEEEVSCTSCELDMDKTDLESCPTNPDIELKTTERDSYAFLFQAIFTAQQAFSRQLIDQEMEDQKFNINSEIIEQLVTQDLWFSMLPFWKVNQSLPHSESDIANLPYIQTAASRSLHALFRQEKIRYETPCLIRGNELCSRDPGVSHYSYFKRDHLRVMVRLQNEPLSLKDSALKKWTQLLLEPMSGQKEVSVLSINFSNYSEKISYEQFIQDLKFMYELMNFGKMNELKLSKYPDGQVIVDSGLLSEEELESFKSVNIRSFWTQLGSCIATEHPTKNVMILIFFEGEKQGLRLLNVCGAFNILKEEYIRVKKQQKLSGEGDVSFQSFPFSMFQQNNLFMGITSTFFTDFLFNIYDRCFIKTCTQQFRQPAYLLLKPISDEPEFQMLPVHVPSVYLSNQELHVTYATVFQRWVVFVWCDSYGEILDVRTYVKELESLDNVLKKAWNDTLKLITPFQTSWSINVMKIDALGMCEINCWRCIQKKHTELHMSLGYFLIPNSRRADSDTLFRIQALKFEESEAIPDNSFACFYKGPLKQINPLLRDTGYLIITRGIFCLCERRNFIPILEVNLAFSAFPSMDAMHKLFNQYSHMCSRLPRLFVTQSHLPFHVSTTLYYKQLIEMVVSELKETETKSASGFG
Length1131
PositionKinase
OrganismSchizosaccharomyces japonicus (strain yFS275 / FY16936) (Fission yeast)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina> Schizosaccharomycetes> Schizosaccharomycetales> Schizosaccharomycetaceae> Schizosaccharomyces.
Aromaticity0.12
Grand average of hydropathy-0.276
Instability index49.00
Isoelectric point5.23
Molecular weight130239.48
Publications
PubMed=21511999

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
ECO:0000256	RuleBase:RU364134
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP25333
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     173.81|      44|      83|     616|     673|       1
---------------------------------------------------------------------------
  616-  660 (76.07/49.76)	EKIRYETpCLIRG.............NELCSRDPG......VSHYSYFKRDHLRV.MV...RLQNEPL
  696-  744 (41.96/32.75)	EKISYEQ..FIQDlkfmyelmnfgkmNEL.....K......LSKYP..DG...QV.IVdsgLLSEEEL
  848-  894 (55.78/31.45)	....YDR.CFIKT.............CTQQFRQPAylllkpISDEPEFQMLPVHVpSV...YLSNQEL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.70|      19|     113|      55|      74|       3
---------------------------------------------------------------------------
   55-   74 (31.50/24.78)	INDENVYTFFlRQEDQKHYE
  170-  188 (36.19/23.70)	IPNGTFYTFF.RSSKYRVYK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.67|      12|     125|     380|     397|       4
---------------------------------------------------------------------------
  247-  258 (26.41/ 8.54)	RSTQS.MNEYSWP
  384-  396 (20.27/ 9.97)	RSTQSkFNVPSGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     201.94|      60|      83|     925|     990|       5
---------------------------------------------------------------------------
  925-  990 (101.50/90.88)	KELESL.DNVLKKAWNDTLKLITPFQTSWSINVMKIDALGMCEINCWRCIqkkhteLHMSLGYFLIP
 1009- 1069 (100.44/75.55)	EESEAIpDNSFACFYKGPLKQINPLLRDTGYLIITRGIFCLCERRNFIPI......LEVNLAFSAFP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25333 with Med13 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) NHRSTQSKFNVPSGPTGTTRTEHYSGDYGSEKSTSVTSSF
382
421










Molecular Recognition Features






MoRF SequenceStartStop




NANANA