<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25327
| Description |
CMGC/CDK/CDK8 protein kinase Srb10 |
| Sequence | MEKKRYNILGFISAGTYGKVYKATAKDSKQPGIFAIKRFKPESKFSNGQNVTNGISQSAIREISLCRELHHENIVNLVDVMIDGTNISMVFEYAEYDLLQIIQFHLRPRPHPIPKSIIKSFTWQILNGIAYLHENWILHRDLKPANILITEEGVVKVGDLGLGRIFRDSLQSLYASDRVVVTIWYRAPELLLGARNYTPAIDMWAIGCVFAEILALGPLFKGEEMKMETKKVVPFQKNQMLRIMEVLGTPTEERWPGLSQYPEYHQLATYDVQYWNNLLPQWYHSVKANDPDGLDLLMKLLEYDPSKRISAKDALSHSFFTRDSNWNKVAFKDHEVRYPRRRISVESEEPSVKRSAAVPLYGLSKHTKL |
| Length | 369 |
| Position | Kinase |
| Organism | Schizosaccharomyces japonicus (strain yFS275 / FY16936) (Fission yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina>
Schizosaccharomycetes> Schizosaccharomycetales> Schizosaccharomycetaceae>
Schizosaccharomyces.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.321 |
| Instability index | 42.96 |
| Isoelectric point | 9.10 |
| Molecular weight | 42513.54 |
| Publications | PubMed=21511999
|
Function
| Annotated function |
|
| GO - Cellular Component | euchromatin GO:0000791 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:EnsemblFungi
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP25327
No repeats found
|