<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25326
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MGLLKSIQDVEKCVNQHLKLSIEGASIETLMDNWQSTLKNLVQFKSLIEEYERGVELQKTIQKLLKEGEELDGKLESCMEELAVLHKGIEPKSILEGKKRKVSLKMLLEYGAKLAKFSSAPPGYDPEKGQEGNAPVHFPWPSEDQMRKTKLLQLATDNSSLEAGQMVQDEEKQQTSVKVEIDEVLPSFDKPATDSAVTTTTGLTTTTSPSMMHVDQGTHPPPTAPVEEKPDVFAGLDLYDPENDDLL |
Length | 247 |
Position | Middle |
Organism | Schizosaccharomyces japonicus (strain yFS275 / FY16936) (Fission yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina>
Schizosaccharomycetes> Schizosaccharomycetales> Schizosaccharomycetaceae>
Schizosaccharomyces.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.566 |
Instability index | 49.71 |
Isoelectric point | 4.77 |
Molecular weight | 27406.80 |
Publications | PubMed=21511999
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP25326
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 104.70| 35| 44| 38| 77| 1
---------------------------------------------------------------------------
38- 77 (46.69/39.20) LKNLVQFKSLIEEYERGVELqktiQKLLKEGEELdGKLES
85- 119 (58.01/34.09) LHKGIEPKSILEGKKRKVSL....KMLLEYGAKL.AKFSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.22| 21| 42| 125| 145| 2
---------------------------------------------------------------------------
125- 145 (41.47/29.92) DPEKGQEG.NAPVHFPWPSEDQ
169- 190 (30.75/20.31) DEEKQQTSvKVEIDEVLPSFDK
---------------------------------------------------------------------------
|