<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25322
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDRTHPASFQARPPSPSSPAGSLKENHRLPISSEHIPQTPTSPPLMSVSEQSHAANFISSHTSPNQATVQPPNISSPPSSAPMSTQVSQQPTMSTKNSFPTPASSVSGHPVNATSEDVDQGRKSFNIGIQDSAENSGAGAAQQPAQQQTQHRPTDHDRQSLQTDRTNDFAAGQGQHSTDPDAMDVDTDPTRRANTLSLDLDSLQKELTSAFHLCKRSPIVTGPDPSVDLVSLYGLGPIANSVARTDPVTGEKINRLRKSYEGKLKGLGLAGRNKPHKQEIGAPGSLRHMTLWPEEEWQNQKVHGKAIKVADMDSALQNLQSRAMQMEPGPIPNNDFWEDILGETGKKAAAAPSAGRSSTQSYAATPQAQEAERPRPSRGRKRHYDDNSFAGYGEGFVDDDDDPGFYSNGEGTGKKKRKKVLHSHGNLLC |
| Length | 430 |
| Position | Head |
| Organism | Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) (Penicillium chrysogenum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium>
Penicillium chrysogenum species complex.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.914 |
| Instability index | 57.50 |
| Isoelectric point | 6.60 |
| Molecular weight | 46334.36 |
| Publications | PubMed=18820685
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25322
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 94.67| 20| 26| 14| 39| 1
---------------------------------------------------------------------------
14- 39 (33.96/22.02) PP....SPSSPAGSLkenhrlPISSEHIP.Q
44- 67 (25.48/ 7.81) PPlmsvSEQSHAANF.......ISSHTSPnQ
72- 90 (35.23/13.16) PP....NISSPPSSA......PMSTQ.VS.Q
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.80| 21| 22| 146| 167| 2
---------------------------------------------------------------------------
146- 167 (35.72/24.59) AQQQTQHrPTDHDRQSLQTDRT
171- 191 (40.08/23.13) AAGQGQH.STDPDAMDVDTDPT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.83| 25| 26| 198| 223| 3
---------------------------------------------------------------------------
198- 223 (39.58/26.30) SLDLDSLQKELTSAFHLCKRSPiVTG
227- 251 (43.26/24.64) SVDLVSLYGLGPIANSVARTDP.VTG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.28| 20| 20| 263| 282| 5
---------------------------------------------------------------------------
263- 282 (34.29/22.39) GKLKGLGLAGRNKPHKQEI.G
285- 305 (34.00/22.14) GSLRHMTLWPEEEWQNQKVhG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.83| 11| 14| 386| 396| 6
---------------------------------------------------------------------------
386- 396 (22.39/15.85) DDNSFAGYGEG
402- 412 (23.44/16.98) DDPGFYSNGEG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.89| 14| 19| 350| 363| 7
---------------------------------------------------------------------------
350- 363 (23.45/10.73) AAAPSAGRSSTQSY
372- 385 (26.44/12.92) AERPRPSRGRKRHY
---------------------------------------------------------------------------
|