<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25309
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MANVALTQPQRHNVYIVKYKLDRSCPEGDWAIYVKTEEHTGDIHYIASKDAGAHLCYTRTKIGAHEVTKEGEGPVLIGTTLTQNYPGGWDEALGVVKENLRFETTCLTLPGSTQAGVKVSRWTQECARPALERAGLLEKMESKEIEEKKKKKKKKEGKEGCGVRIWISGEEEKALTSFCHFTPRLLYTMENPPTLTNPRFTLELEFVSSLANPYYLSHLAVTYPNLLGISRADDDDGSSSPDAQAFAAYLAYLYSYWKTPEYSQFLTHPGPTLRALRLLQEDTFRRDIILPQVIEGLAGVSVPEPAQTETDTAGEKQEDSQNQKT |
Length | 325 |
Position | Middle |
Organism | Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) (Penicillium chrysogenum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium>
Penicillium chrysogenum species complex.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.554 |
Instability index | 45.02 |
Isoelectric point | 5.72 |
Molecular weight | 36392.63 |
Publications | PubMed=18820685
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP25309
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.17| 15| 18| 101| 116| 1
---------------------------------------------------------------------------
101- 116 (23.43/18.78) RFETTClTLPGSTQAG
121- 135 (28.75/18.26) RWTQEC.ARPALERAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 198.88| 61| 76| 182| 244| 2
---------------------------------------------------------------------------
182- 244 (103.07/59.41) TPRLLYTMENP.PTLTNPRFTLELEFVSSLANPYYLSHLA.VTYPNllGISRADDDDGSSSPDAQ
259- 321 (95.81/50.56) TPEYSQFLTHPgPTLRALRLLQEDTFRRDIILPQVIEGLAgVSVPE..PAQTETDTAGEKQEDSQ
---------------------------------------------------------------------------
|