<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25308
| Description |
Pc13g15460 protein |
| Sequence | MFGKGFPFMNSGGFYSHAIESRRPGGYTSKVRVRDRYNIVGFISSGTYGRVYKAVGKNGKKGEFAIKKFKPDKEGETIQYTGLSQSAIREMALCTELSHANVVQLEEIILEDKCIFMVFEYTEHDLLQIIHHHTQPQRHAIPAPMVRSIMFQLLNGLLYLHTNWVLHRDLKPANILVTSSGAIRIGDLGLARLFYKPLNSLFSGDKVVVTIWYRAPELLMGSRHYTPAVDMWAIGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMMKIVEILGLPRKESWPGLASMPEYSQLQSLVLHRQPSHFHRGSNLEGWYQSCLKNGGYSSTSSAGTPGADGFDLLSRMLEYDPSKRMTAEQALEHPYFTNGGPISGNCFEGIEGKYPHRRVTQDDNDIRTGSLPGTKRSGLPDDSLMRASKRLKE |
| Length | 423 |
| Position | Kinase |
| Organism | Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) (Penicillium chrysogenum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium>
Penicillium chrysogenum species complex.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.373 |
| Instability index | 41.72 |
| Isoelectric point | 9.27 |
| Molecular weight | 47656.19 |
| Publications | PubMed=18820685
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25308
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 120.05| 37| 85| 188| 237| 1
---------------------------------------------------------------------------
188- 237 (57.56/68.50) LGLARLF..........YKPLNSLfsgdkvvvtIWYRAPELLmgsrHYTPAVDMWAIGCI
275- 321 (62.49/42.63) LGLPRKEswpglasmpeYSQLQSL.........VLHRQPSHF....HRGSNLEGWYQSCL
---------------------------------------------------------------------------
|