<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25307
| Description |
Pc13g03640 protein |
| Sequence | MDPTTPSDWPPSDLSSSSEDNKKNAPTMDSRPTAKELLDRVDYDISQLLQRFENIIAIAAKKFDGTSHVDAAVEAFQIDVESTALIRAAEDLLALHRLMKELWLFGKLDTLGEDERDIQRREKLEEDVKAIQKALDGGLLMPSSEEPDKPEKSEDTEKHRAVPEA |
| Length | 165 |
| Position | Head |
| Organism | Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) (Penicillium chrysogenum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium>
Penicillium chrysogenum species complex.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.716 |
| Instability index | 54.28 |
| Isoelectric point | 4.58 |
| Molecular weight | 18515.46 |
| Publications | PubMed=18820685
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25307
No repeats found
No repeats found
|