<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25300
| Description |
Mediator of RNA polymerase II transcription subunit 13 |
| Sequence | MSSCFVPNGASLEDCHSNLFCLVRDLKLKEKQPFLTS |
| Length | 37 |
| Position | Middle |
| Organism | Salmo salar (Atlantic salmon) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Salmo.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.038 |
| Instability index | 63.61 |
| Isoelectric point | 6.51 |
| Molecular weight | 4158.80 |
| Publications | PubMed=20433749
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25300
No repeats found
No repeats found
|