<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25300
Description |
Mediator of RNA polymerase II transcription subunit 13 |
Sequence | MSSCFVPNGASLEDCHSNLFCLVRDLKLKEKQPFLTS |
Length | 37 |
Position | Middle |
Organism | Salmo salar (Atlantic salmon) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Salmo.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.038 |
Instability index | 63.61 |
Isoelectric point | 6.51 |
Molecular weight | 4158.80 |
Publications | PubMed=20433749
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP25300
No repeats found
No repeats found
|