Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAVTDKSTKERLLSVLDDLEVLSRELIEMLALSRSQKLPQGGEDTQILELLVQRDREFQELMGVAQEQGKVHQEMQVLEKEVEKRDCDIQQLQKQLKEAEHILATAVYQAKEKLKSIDKARKGSISSEEIIKYAHRISASNAVCAPLNWVPGDPRRPYPTDLEMRSGMLGHMSNLPTNGVNGHLPGDALAAGRLPGILLLCAYTPVPLAIVRRLSGYAPPAPWQRLWTGAPRPQQRERGRRGSHVYRLIQQQQRLRLTG |
Length | 259 |
Position | Middle |
Organism | Salmo salar (Atlantic salmon) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes> Salmonidae> Salmoninae> Salmo. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.512 |
Instability index | 47.72 |
Isoelectric point | 9.25 |
Molecular weight | 29160.28 |
Publications | PubMed=20433749 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP25298 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.27| 18| 32| 24| 55| 1 --------------------------------------------------------------------------- 19- 36 (27.97/ 8.62) LEVL...SRELIEMLALSRSQ 48- 68 (25.30/36.70) LELLvqrDREFQELMGVAQEQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 51.43| 14| 32| 140| 153| 2 --------------------------------------------------------------------------- 140- 153 (28.63/20.21) SNAVCAPLN.WVPGD 173- 187 (22.80/14.76) SNLPTNGVNgHLPGD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 86.81| 30| 33| 71| 102| 3 --------------------------------------------------------------------------- 71- 102 (42.50/43.26) VHQEMQVLeKEVEK.RDCDIQQlQKQLKEAEHI 107- 137 (44.31/33.91) VYQAKEKL.KSIDKaRKGSISS.EEIIKYAHRI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) HVYRLI 2) WQRLWT | 244 223 | 249 228 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab