Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MEAPPVSVLPITGGTINMMEYLLQGSVLDQALESLLHRLRGLCDNMEPETFADHELVYLLKGQQGNPFLLRARRSLSHPTVPWHLRYLGQPEVGDKSRHVLVRNCVDVAASHSLPDFLNEMGFRMDHEFVAKGHIFRKGVLKVVVSKLSRILVPGNTENTEPLSLSYLVELSVLAPAGQDTMSEDMRSFAEQLKPLVHLEKIDPKRHM |
Length | 208 |
Position | Head |
Organism | Salmo salar (Atlantic salmon) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes> Salmonidae> Salmoninae> Salmo. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.158 |
Instability index | 44.23 |
Isoelectric point | 6.36 |
Molecular weight | 23395.86 |
Publications | PubMed=20433749 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP25295 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 132.81| 41| 70| 40| 82| 1 --------------------------------------------------------------------------- 40- 82 (70.54/57.49) RGLCDNMEPETF.ADHELVylLKGQQGNPFLLRARRS.LSHPTVP 112- 154 (62.27/43.23) HSLPDFLNEMGFrMDHEFV..AKGHIFRKGVLKVVVSkLSRILVP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 61.91| 19| 144| 13| 31| 2 --------------------------------------------------------------------------- 13- 31 (34.84/24.02) GGTINM....MEYLLQGSVLDQA 155- 177 (27.07/17.35) GNTENTeplsLSYLVELSVLAPA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LVHLEKIDPKRHM 2) WHLRYL | 196 83 | 208 88 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab