<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25287
| Description |
Uncharacterized protein |
| Sequence | MLDIARKKLNWQHYRKINRKKNKQRSRLAAFCKQTKVFFIADIMASGSRITILPQSKEALLKSYNVRLKEDVRSMLENFEETLKLARRDSHSQISRTTQSEQDALEMQIRASNMVRAGESLMKLVADLKQYLILNDFHSVNEAITNNSQLFRSTQIECDKKLMKLRDEMAMDLYDLEEEYYTSIFK |
| Length | 186 |
| Position | Head |
| Organism | Drosophila pseudoobscura pseudoobscura (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.611 |
| Instability index | 49.97 |
| Isoelectric point | 9.47 |
| Molecular weight | 21952.13 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25287
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.94| 19| 55| 92| 110| 1
---------------------------------------------------------------------------
92- 110 (32.93/23.57) SQISRTTQSEQDALEMQIR
148- 166 (34.01/24.56) SQLFRSTQIECDKKLMKLR
---------------------------------------------------------------------------
|