Description | Uncharacterized protein |
Sequence | MATKQEEQANLSDVLTPSMSLTELEMKFADETDGKAKDVVQARIKKAEDGILPLRLQFNDFTQIMSSLDEERYANVSKQEKFQMIRSKVLGLTERLQELSNDFEELQPLFATVGEYSKTYKNKNFQVLENLASYNHRGKAGASISNSTPTPAAATPTTAPTPGAGTKKAAKTAPTPTATATIGTPSNNAPTPATTATTPGTQAKKPRKPRQTKKQQQAAAAAAAVAQAQAQAQAQAQNQNQNNMQNKNISNPGMNSNMGTPVMGNPNMKQMQSPIPANAMNNMNVPHNGAMRPSVPNGNMGNPSMGNLNMNAPNMGNPNMNNPNMNNPNAMMSPMAGQGQLNQMFPMQNHNQNGHFMGQQSPGPNIGQMQFPPNNGNMNGMPGTSDMNLGMNPSMNMNMGMNMNQITPANILSMNTKGKDDQMQNIGMDQNQNQNQNQNQNQSMNMNMNNDSNNPKSAYDLVDFNSLDLSSLNMDFL |
Length | 477 |
Position | Tail |
Organism | Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Nakaseomyces> Nakaseomyces/Candida clade. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.867 |
Instability index | 36.27 |
Isoelectric point | 8.84 |
Molecular weight | 51680.42 |
Publications | PubMed=15229592 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP25276 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 100.36| 21| 22| 293| 313| 1 --------------------------------------------------------------------------- 251- 269 (34.94/ 9.00) NP........GMNSNMGTPVMGNPNMK 285- 311 (35.98/ 9.50) VPhngamrPSVPNGNMGNPSMGNLNMN 430- 449 (29.45/ 6.36) QN.....qNQNQNQNQ.NQSM.NMNMN --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 63.66| 19| 22| 347| 367| 2 --------------------------------------------------------------------------- 348- 369 (32.17/12.88) QNHNQNGHFMGQqsPGP...NIGqM 370- 391 (31.49/ 8.43) QFPPNNGNMNGM..PGTsdmNLG.M --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 98.75| 27| 40| 145| 182| 3 --------------------------------------------------------------------------- 145- 175 (45.93/36.26) SNSTPTPAaatpTTAPTPGAGTKKAAKTAPT 186- 212 (52.82/20.91) SNNAPTPA....TTATTPGTQAKKPRKPRQT --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 89.26| 32| 40| 45| 83| 4 --------------------------------------------------------------------------- 45- 83 (44.18/48.40) KKAEDgilplRLQ..FNDFTQI...MSSLDEerYANVSKQEKFQ 90- 126 (45.08/29.77) LGLTE.....RLQelSNDFEELqplFATVGE..YSKTYKNKNFQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 94.83| 27| 76| 317| 344| 6 --------------------------------------------------------------------------- 317- 344 (52.17/20.85) NPNMN...NPNMNN..PNAMMSpMAGQGQLNQM 392- 423 (42.66/12.84) NPSMNmnmGMNMNQitPANILS.MNTKGKDDQM --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DLVDFNSLDL 2) KKAAKTA 3) SLNMDFL | 460 167 471 | 469 173 477 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab