<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25276
| Description |
Uncharacterized protein |
| Sequence | MATKQEEQANLSDVLTPSMSLTELEMKFADETDGKAKDVVQARIKKAEDGILPLRLQFNDFTQIMSSLDEERYANVSKQEKFQMIRSKVLGLTERLQELSNDFEELQPLFATVGEYSKTYKNKNFQVLENLASYNHRGKAGASISNSTPTPAAATPTTAPTPGAGTKKAAKTAPTPTATATIGTPSNNAPTPATTATTPGTQAKKPRKPRQTKKQQQAAAAAAAVAQAQAQAQAQAQNQNQNNMQNKNISNPGMNSNMGTPVMGNPNMKQMQSPIPANAMNNMNVPHNGAMRPSVPNGNMGNPSMGNLNMNAPNMGNPNMNNPNMNNPNAMMSPMAGQGQLNQMFPMQNHNQNGHFMGQQSPGPNIGQMQFPPNNGNMNGMPGTSDMNLGMNPSMNMNMGMNMNQITPANILSMNTKGKDDQMQNIGMDQNQNQNQNQNQNQSMNMNMNNDSNNPKSAYDLVDFNSLDLSSLNMDFL |
| Length | 477 |
| Position | Tail |
| Organism | Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) (Yeast) (Torulopsis glabrata) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Nakaseomyces>
Nakaseomyces/Candida clade.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.867 |
| Instability index | 36.27 |
| Isoelectric point | 8.84 |
| Molecular weight | 51680.42 |
| Publications | PubMed=15229592
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25276
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 100.36| 21| 22| 293| 313| 1
---------------------------------------------------------------------------
251- 269 (34.94/ 9.00) NP........GMNSNMGTPVMGNPNMK
285- 311 (35.98/ 9.50) VPhngamrPSVPNGNMGNPSMGNLNMN
430- 449 (29.45/ 6.36) QN.....qNQNQNQNQ.NQSM.NMNMN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.66| 19| 22| 347| 367| 2
---------------------------------------------------------------------------
348- 369 (32.17/12.88) QNHNQNGHFMGQqsPGP...NIGqM
370- 391 (31.49/ 8.43) QFPPNNGNMNGM..PGTsdmNLG.M
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 98.75| 27| 40| 145| 182| 3
---------------------------------------------------------------------------
145- 175 (45.93/36.26) SNSTPTPAaatpTTAPTPGAGTKKAAKTAPT
186- 212 (52.82/20.91) SNNAPTPA....TTATTPGTQAKKPRKPRQT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.26| 32| 40| 45| 83| 4
---------------------------------------------------------------------------
45- 83 (44.18/48.40) KKAEDgilplRLQ..FNDFTQI...MSSLDEerYANVSKQEKFQ
90- 126 (45.08/29.77) LGLTE.....RLQelSNDFEELqplFATVGE..YSKTYKNKNFQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 94.83| 27| 76| 317| 344| 6
---------------------------------------------------------------------------
317- 344 (52.17/20.85) NPNMN...NPNMNN..PNAMMSpMAGQGQLNQM
392- 423 (42.66/12.84) NPSMNmnmGMNMNQitPANILS.MNTKGKDDQM
---------------------------------------------------------------------------
|