<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25275

Description GD24373
SequenceMNQIEIQELTTHLSQALDQNYDVVNMDAVLCVICALEGTTITKEQLEATRLAKYINQLRRRTKNEHLARRAKSLLKKWREMVGIQQTATEYLAHPSQISSSQPALNLVKSPINSFITEPIAPSQQIVSDMHSNIDSAEPPLLGEHTLLHPSFSNLVNSIKDSDRHENIAITTFHTHKDPRHSHAIRSCNVASPQPIIINHSIXXXXRHCGGFNQTDSRVFCYSTSIPTEVGERKREKQRPFHLTTEEEN
Length249
PositionUnknown
OrganismDrosophila simulans (Fruit fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila> Sophophora.
Aromaticity0.04
Grand average of hydropathy-0.551
Instability index60.66
Isoelectric point6.92
Molecular weight27771.03
Publications
PubMed=17994087

Function

Annotated function
GO - Cellular Component
core mediator complex	GO:0070847	IEA:EnsemblMetazoa
mediator complex	GO:0016592	IEA:InterPro
nucleolus	GO:0005730	IEA:EnsemblMetazoa
pericentric heterochromatin	GO:0005721	IEA:EnsemblMetazoa
polytene chromosome chromocenter	GO:0005701	IEA:EnsemblMetazoa
GO - Biological Function
GO - Biological Process
positive regulation of gene expression	GO:0010628	IEA:EnsemblMetazoa
regulation of transcription by RNA polymerase II	GO:0006357	IEA:EnsemblMetazoa

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP25275
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.78|      22|      26|      89|     112|       1
---------------------------------------------------------------------------
   89-  111 (35.24/18.90)	TEYLAhPSQ..ISSSQPALNLVKSP
  117-  140 (34.55/14.09)	TEPIA.PSQqiVSDMHSNIDSAEPP
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP25275 with Med26 domain of Kingdom Metazoa

Unable to open file!