<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25267

Description GD19208
SequenceMSNSVNISVETTCENQIREIGYDGTELYQPPPTLSESLAKCAARIDFSKTSLDDLKKEEKSAAAAADEDKDATQFQESLWPWDAVRNKLKDALTEICVLSDVISIAQEQALSGCSIPC
Length118
PositionHead
OrganismDrosophila simulans (Fruit fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila> Sophophora.
Aromaticity0.05
Grand average of hydropathy-0.370
Instability index40.68
Isoelectric point4.32
Molecular weight12901.26
Publications
PubMed=17994087

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblMetazoa
pericentric heterochromatin	GO:0005721	IEA:EnsemblMetazoa

GO - Biological Function
activating transcription factor binding	GO:0033613	IEA:EnsemblMetazoa
transcription coactivator activity	GO:0003713	IEA:EnsemblMetazoa

GO - Biological Process
cellular process	GO:0009987	IEA:EnsemblMetazoa
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:EnsemblMetazoa
sex comb development	GO:0045498	IEA:EnsemblMetazoa









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP25267
No repeats found
No repeats found




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25267 with Med17 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




NANANA









Molecular Recognition Features






MoRF SequenceStartStop




1) CENQIREIGYDGTELYQPPPTLSESLAKCAARIDFSKTSLDDLKKEEKSAAAAADEDKDATQFQESLWPWDAVR
13
86