<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25263

Description GD19329
SequenceMMTSGYAGCVHFSSIPNSPACDLKVLILLYTPDRNAFLGFIPNNQAMFVERLRKVIQQKQHGNMQQQQQQQQMMQQQGKSPMELQQQQQQQQQQMQQDNSQQQHYNQFQLNMQMGGGGPGGGPGPGPGGMPMQQNQMQMNMMQQQRMPLGVGVGVGVGPGGVPNPNLQQQLQQVAPNVAAMQQQQAQQQQQRMVRPMMSNNNPGLRQLLQHQTTPGNQFRPQMGGQNPNQMGAGGPMVGNRNFDDGNYEFM
Length251
PositionUnknown
OrganismDrosophila simulans (Fruit fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila> Sophophora.
Aromaticity0.05
Grand average of hydropathy-0.918
Instability index57.60
Isoelectric point9.62
Molecular weight27934.38
Publications
PubMed=17994087

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
GO - Biological Process
nervous system development	GO:0007399	IEA:EnsemblMetazoa
positive regulation of antibacterial peptide biosynthetic process	GO:0006963	IEA:EnsemblMetazoa









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP25263
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      94.58|      18|      18|      57|      74|       1
---------------------------------------------------------------------------
   54-   71 (32.52/ 7.12)	KVIQQKQHGNMQQQQQQQ
   72-   89 (30.92/ 6.36)	QMMQQQGKSPMELQQQQQ
   90-  107 (31.14/ 6.46)	QQQQQMQQDNSQQQHYNQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     119.02|      23|      24|     181|     203|       2
---------------------------------------------------------------------------
  132-  165 (32.55/ 6.80)	MQQNQMQmnmMQQQRMplgvgvgvgVGP.GGVPNP
  181-  203 (47.79/13.59)	MQQQQAQ...QQQQRM.........VRPMMSNNNP
  208-  228 (38.68/ 9.53)	LLQHQTT...PGNQ...........FRPQMGGQNP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25263 with Med25 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) RLRKVIQQKQHGNMQQQQQQQQMMQQQGKSPMELQQQQQQQQQQMQQDNSQQQHYNQFQLNMQMGGGGPGGGPGPGPGGMPMQQNQMQMNMMQQQRMPLGVGVGVGVGPGGVPNPNLQQQLQQVAPNVAAMQQQQAQQQQQRMVRPMMSNNNPGLRQLLQHQTTPGNQFRPQMGGQNPNQMGAGGPMVGNRNFDDGNYEFM
51
251










Molecular Recognition Features






MoRF SequenceStartStop




NANANA