<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25241
Description |
Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MMDLSPNNQIEDRKPILTADGLVQTSNSPFEPTISQETQTSNGIGGQCHLTVDQLDIEILPIIYDIVRCVEKDPLENAVKLRESQDCNHKIFELQKRFESAREQIRQLPGIDFNKEEQQQRLELLRNQLKLKQQLIRKYKDTEFMVLRLLMRYLANNEQLIQRMAESYPMRRAAQLVVSLMYRTKDLAREQGLHEMTPERFKSFVNMFKNNVRQELEGVKKELNSKKKN |
Length | 229 |
Position | Middle |
Organism | Drosophila simulans (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.733 |
Instability index | 46.49 |
Isoelectric point | 8.68 |
Molecular weight | 26979.76 |
Publications | PubMed=17994087
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP25241
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.67| 20| 23| 86| 107| 1
---------------------------------------------------------------------------
82- 105 (26.30/19.28) RE..sqDCNHKifELQKRFESAREQI
106- 129 (29.37/15.18) RQlpgiDFNKE..EQQQRLELLRNQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.13| 13| 24| 133| 145| 2
---------------------------------------------------------------------------
133- 145 (22.86/15.61) QQLIRKYKDTEFM
158- 170 (23.27/16.01) EQLIQRMAESYPM
---------------------------------------------------------------------------
|