<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25240

Description GD15252
SequenceMNPNMNMMPMSGPQMMQVMQSSPSGPPGPVQHQQQQPPQPLQQQQAEKLDNISRVKSLLGPLRESMFLTIRSSAFTLQQNNLADNLKRDTGAHHVPRFDKHLEDFYACCDQIEIHLKTAMQCLQQQNSSNHYLPGPVTPMRMETFMPDNAGPISYPTYLNTVRVHIQSAKDIHDTLISAAQNISQAD
Length187
PositionTail
OrganismDrosophila simulans (Fruit fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila> Sophophora.
Aromaticity0.05
Grand average of hydropathy-0.629
Instability index74.05
Isoelectric point6.42
Molecular weight21048.73
Publications
PubMed=17994087
PubMed=22936249

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblMetazoa

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:EnsemblMetazoa
transcription factor binding	GO:0008134	IEA:EnsemblMetazoa

GO - Biological Process
genital disc sexually dimorphic development	GO:0035263	IEA:EnsemblMetazoa
imaginal disc-derived female genitalia morphogenesis	GO:0048804	IEA:EnsemblMetazoa
negative regulation of cell death	GO:0060548	IEA:EnsemblMetazoa
regulation of transcription by RNA polymerase II	GO:0006357	IEA:EnsemblMetazoa
sex determination	GO:0007530	IEA:EnsemblMetazoa









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP25240
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.41|      17|     122|       2|      30|       1
---------------------------------------------------------------------------
   14-   30 (34.88/29.65)	QMMQVMQSSPSGPPGPV
  121-  137 (34.54/ 8.75)	QCLQQQNSSNHYLPGPV
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25240 with Med29 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MNPNMNMMPMSGPQMMQVMQSSPSGPPGPVQHQQQQPPQPLQQQQAEKLDNISRV
1
55










Molecular Recognition Features






MoRF SequenceStartStop




NANANA