<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25237
Description |
Uncharacterized protein |
Sequence | MADRLTQLQDTVNQQAEHFCNAIGVIQQTSYPSKFANFDRTGSQTPNQNQPQEDYAQLFAQLIARCAKDIDTLIESLPNEDSSIELQNSSLKRLEVENQETAEELEQVVQKGELLLEKIQSALEDIAQAQLDMQVTVKPS |
Length | 140 |
Position | Middle |
Organism | Drosophila willistoni (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.604 |
Instability index | 44.33 |
Isoelectric point | 4.27 |
Molecular weight | 15737.25 |
Publications | PubMed=17994087
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP25237
No repeats found
No repeats found
|