<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25229
Description |
Uncharacterized protein |
Sequence | MSSNEAGSGNLMDEFEEAFQLCLLSLTKQEPNSGTNKEEIELEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPHMLIKDENQDLHHEIQRKDALLQKHYNRLEEWKACLSDIQQGGHSRPSPSIMQIPGGPIMPQGGPRPGMMGPGMPPGGMSPSQQQLLQAQQMQQLRMMGKLPPK |
Length | 178 |
Position | Head |
Organism | Drosophila willistoni (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.701 |
Instability index | 70.55 |
Isoelectric point | 6.52 |
Molecular weight | 20079.91 |
Publications | PubMed=17994087
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblMetazoa
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:EnsemblMetazoa
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
Repeats |
>MDP25229
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.82| 9| 19| 115| 126| 1
---------------------------------------------------------------------------
115- 126 (14.62/12.46) QGGhsrPSPSIM
136- 144 (21.19/ 9.23) QGG...PRPGMM
---------------------------------------------------------------------------
|