Description | Mediator of RNA polymerase II transcription subunit 11 (Fragment) |
Sequence | MNPLDKIHALDEIEKEIILCMQSAGQALQELGKEKSSQKNAETQSQQFLKSLSSVESKLSEQINYLTQVSTGQPHEGSGYASAKVLQMAWHRIQHARSRVRELEETKAKHSHAARQQQKRQQEHAAAQQQQQQQQQQQQQQQQQAAAAAAQQQQQ |
Length | 155 |
Position | Head |
Organism | Drosophila willistoni (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila> Sophophora. |
Aromaticity | 0.03 |
Grand average of hydropathy | -1.174 |
Instability index | 78.66 |
Isoelectric point | 8.74 |
Molecular weight | 17574.21 |
Publications | PubMed=17994087 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblMetazoa |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:EnsemblMetazoa |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa |
Binary Interactions |
Repeats | >MDP25223 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 55.63| 16| 16| 121| 136| 1 --------------------------------------------------------------------------- 121- 136 (28.99/ 8.55) QQEHAAAQQQQQQQQQ 140- 155 (26.65/ 7.22) QQQQQAAAAAAQQQQQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) QFLKSLSSVESKLSEQINYLTQVSTGQPHEG 2) YASAKVLQMAWHRIQHARSRVRELEETKAKHSHAARQQQKRQQEHAAAQQQQQQQQQQQQQQQQQAAAAAAQQQQQ | 47 80 | 77 155 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab