Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MSFHLSTKERLLLLIDDIEMIAKELIEQAHQKISSNELVDLLDLLVSKDEEFRKMLELAEEQAKVEESMDKLRAKVEVHDREIQKLQKSLKDAELILSTAIFQARQKLASINQANKRPVSSEELIKYAHRISSANAVSAPLTWCIGDLRRPYPTDIEMRNGLLGKSEQNLNGSGPMTHQNSGLTTDQRSLGSGSGSGSGSGGGGGGSSGGGGSGEVPNAFQNQFNWNLGELHMMGASGGSVALETRAQDDVEVMSTDSSSSSSSDSQ |
Length | 267 |
Position | Middle |
Organism | Drosophila willistoni (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila> Sophophora. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.505 |
Instability index | 50.24 |
Isoelectric point | 5.08 |
Molecular weight | 28776.75 |
Publications | PubMed=17994087 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblMetazoa |
GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblMetazoa |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa |
Binary Interactions |
Repeats | >MDP25220 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 55.11| 15| 18| 181| 195| 1 --------------------------------------------------------------------------- 181- 195 (26.99/10.54) SGLTTDQRSLGSGSG 200- 214 (28.13/11.24) SGGGGGGSSGGGGSG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.09| 28| 28| 27| 54| 2 --------------------------------------------------------------------------- 11- 41 (38.08/25.15) LLLLIDDIEMIAKeliEQAHQKISSNELVDL 42- 71 (37.01/24.26) LDLLVSKDEEFRK.mlELAEEQAKVEESMDK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PNAFQNQFNWNLGELHMM 2) SVALETRAQDDVEVMSTDSSSS | 217 240 | 234 261 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab