<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25216
| Description |
Uncharacterized protein |
| Sequence | MNSNMNMMSMGGPPMMQVMQSSPQPMMPGSGSGPVPVQHQQQQQQQQAEKLDNISKVKSLLAPLRESMFLTIRSSAFTLQQNNLADNLKRDTTAHGHHNPRFDKHLEDFYACCDQIELHLKTAMQCMQQQNSSNHYLPGMVTPMRMESFITDNAGPIPYPTYLNTVRVHVQSAKDIHDTLISAAQNISQAD |
| Length | 191 |
| Position | Tail |
| Organism | Drosophila willistoni (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.593 |
| Instability index | 62.17 |
| Isoelectric point | 6.48 |
| Molecular weight | 21425.16 |
| Publications | PubMed=17994087
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25216
No repeats found
|