<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25196
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MSTPETQVSSLPMPPERYISNYTEENIRRNRAPRPPPPPSQHEVYSMFGIQYNNDEMIRSLESQNIKRLIPIHFDRRKELKKLNHSLLVNFLDLIDFLILNPDSPRRTEKIDDLSLLFVNMHHLLNEFRPHQARETLRVMMEMQKRQRVETATRFQKHLERVRDIVNSAFSALPTLFDEDENGGAKVKMEVDPLDSNAAAKNDPSYQHDRMMCKLVDAID |
Length | 220 |
Position | Middle |
Organism | Drosophila virilis (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.728 |
Instability index | 51.50 |
Isoelectric point | 6.46 |
Molecular weight | 25822.19 |
Publications | PubMed=17994087
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:EnsemblMetazoa
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
Repeats |
>MDP25196
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.03| 24| 27| 69| 95| 1
---------------------------------------------------------------------------
72- 95 (40.49/26.50) IHFDRRKELKKLNH.SLL.VNFLDLI
100- 125 (33.54/13.92) LNPDSPRRTEKIDDlSLLfVNMHHLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.83| 19| 20| 12| 30| 2
---------------------------------------------------------------------------
12- 30 (36.19/19.02) PMPPERYISNYTEENIRRN
35- 53 (38.64/20.70) PPPPPSQHEVYSMFGIQYN
---------------------------------------------------------------------------
|