<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25183

Description Uncharacterized protein
SequenceMWKFGQNQMNQSPQGGGGPNMMPMGGFMQGGAGMHMSPQQQQQHQMNMMSGGGPGGPGSMQINPNAGSGGGPPGLMQGMGMSPQHQMQQQHQMMQGGVGVPMSNMPQQQGNAMQQQMMGPQQGVGMGGGGGPQQQQPNMPQQQQQQQQHNPGTSAAGGGGGGNNMLAISQPNPHKEINIVQLSRLGQETVQDIASRFQEVFSALKNIQPTSHRDNNTEKKVQEYFRTIRLLFKRVRIIYEKCNDAGMDYMNAESLIPYRDEPDPRIEPSQCDEYRKVLQENQELIETVKLKNRQLREIIDRTRIIIWEINTMLAMRRS
Length318
PositionHead
OrganismDrosophila virilis (Fruit fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila.
Aromaticity0.04
Grand average of hydropathy-0.884
Instability index70.95
Isoelectric point8.91
Molecular weight35198.58
Publications
PubMed=17994087

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblMetazoa

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:EnsemblMetazoa

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:EnsemblMetazoa









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP25183
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.97|      21|      24|      93|     116|       1
---------------------------------------------------------------------------
   29-   49 (44.75/ 9.84)	QGGAGMHMS..PQQQQQH.QMNMM
   95-  118 (37.22/12.99)	QGGVGVPMSnmPQQQGNAmQQQMM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.62|      23|      32|     120|     143|       2
---------------------------------------------------------------------------
  120-  143 (48.59/15.77)	PQQ...GVGMGGGGGPQQQ.....QPNmPQQQ
  146-  176 (33.03/ 6.86)	QQQhnpGTSAAGGGGGGNNmlaisQPN.PHKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.45|      23|      25|     178|     200|       5
---------------------------------------------------------------------------
  178-  200 (36.17/22.35)	NIVQLSRLGQETVQDIASRFQEV
  206-  228 (39.28/24.79)	NIQPTSHRDNNTEKKVQEYFRTI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25183 with Med30 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MWKFGQNQMNQSPQGGGGPNMMPMGGFMQGGAGMHMSPQQQQQHQMNMMSGGGPGGPGSMQINPNAGSGGGPPGLMQGMGMSPQHQMQQQHQMMQGGVGVPMSNMPQQQGNAMQQQMMGPQQGVGMGGGGGPQQQQPNMPQQQQQQQQHNPGTSAAGGGGGGNNMLAISQPNPHKEINIVQLSRL
1
185










Molecular Recognition Features






MoRF SequenceStartStop




NANANA