<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25182
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MAKTQASFALQDRSYRNKLNVQLENMNPLDKIHALDEIEKDIILCMQSAGQALQELGKEKSSQKSAETQSQQFLKSLSSVESKLSEQINYLTQVSTGQPHEGSGYASAKVLQMAWHRIQHARSRVRELEETKAKHSHAARQQQKRQQEHAAAQQQQQQQAAAAAAQQQQQQAAGGGVCGSGAAADGAGAGSGNTASGSNAASIAAELGGGLPPN |
| Length | 214 |
| Position | Head |
| Organism | Drosophila virilis (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.750 |
| Instability index | 57.30 |
| Isoelectric point | 8.54 |
| Molecular weight | 22741.83 |
| Publications | PubMed=17994087
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblMetazoa
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:EnsemblMetazoa
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
| Repeats |
>MDP25182
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.45| 12| 15| 173| 187| 1
---------------------------------------------------------------------------
173- 184 (23.93/16.32) AGGGVCGSGAAA
189- 200 (21.51/ 6.14) AGSGNTASGSNA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.41| 15| 15| 48| 62| 3
---------------------------------------------------------------------------
48- 62 (24.51/15.70) SAGQALQELGKEKSS
65- 79 (22.90/14.15) SAETQSQQFLKSLSS
---------------------------------------------------------------------------
|