<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25171

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMAPTPLPLEQMPGANAGYLPAGQEGGPRINTMSMSVLIDFIIQRTYHELMVLAELLPRKTDMERKVEIYAYAARTRHLFTRLNALVKWGNSVSKVDKSSQIMSFLDKQNMLFVETADMLARMSRETLVRARLPNFHIPAAVEVLTTGTYNRLPTCIRERIVPPDAITPAEKRQTLLRLNQVIQHRLVTGKLLPQMRDFRIRNGRVTFEVKHEFSVALTVMGDSPTVPWRLLDIDILVEDKETGDGKSLVHPLQVTYIHQLIQARLVENPNALSEVYNCLHYFCQSLQLEVLYTQTLRLNYERLDDNNINVEEYVPGVKLTVSYWRDLKSELGYRLTVQSDPSEIGRPLVVVHVPSLGAKESAEVADRAVRSEHLSMERLIVHTVYIRSVSRLSDLKLEFQAFLKDVDFNLQGTPAILTVPVLSPCLRAEQIHITIDTHTGMFRCHVPKHLDCPITDEMQECLNTDRSKLPALLSELRYWITHRRCEKTLQHLPATATETLPFLAPPEQELLQPGRHKIYVKLHRHPNIILVVQLKEKSAMPNEMEYTFHLGFVAFQKDENDVIDESAKQLVSIVAQPPSEIPKFYTKLIRLIEFDTFVATHGPGTEVDEVSPHKRKSNGDILAPPAKQQKTIFPAYFIPELAHVVAMCDEKIPFLNLAQTLSKYRIPHSGLQVEANATSLVLKILALPKPGTHQAPGATGEQKPAPAPSTSSALPKIEPHVWEDLMRRVLSISVRSQTNKNSQVRIWVVEFVFYSTPLQSTHQKELGSRRTVNLTYEQATHDFSKTVEDLLNDWSKIVYLYTLVYDFAEQLRNKRLSLGDMLVVKSYTYANLLIGYGPKKEVTCNIYWSVQSNGFRLVFVGGISAVNAHSMMREQLAQHLNQQHSLTSIAHILHETYNPMSSIAKLPVIPVLGVPRPQVPVLSFCMLPQSPCLMRLTYQAVYCLELRFRANRLVSIRDGASNRFDRNIIEEFTPIQGLKAFLSKYVDESAVYRGRAPHDDDNPLSPMGLEDNFGGPNSVAGVSAGGSSPFLSAGMRGPQSPRDSGLRFPAPHTPPSSSNPHTPASPHPSSGGGGASGGQSHANFNLTSPPAPHMPHPSPGGLMPSSPLNPQPSPHMVHSPGPNTLYMQSHQDSPFTAMSPANNNWPGSPSMPRPSPRPGQSPEHKSTGGGGPGVGVGGADRSGSRGTLNRPWAGAVPTLLTHEALETLCRPSPHPNKDINVADMSPLERFLGCVYMRRQLHRNIQSEESLTALNSTEPGVVLFKVDGLQCQVMLNQLHMQSLHLKVTQLPPMPDKPTFQLSPDDLLVIEQYFDTRVAAPPYRPNALHSMCRLLNLPGHVLKDFVQIMRLELKPELGGDQLKWTVQMCLRMSPSALPIVPIGSACVVLGRMKILFFLHITRIPYNGKDWKDSPSLVLPIVHDIASNLTQVAERREQVQSPLMAAASTLLRGFADYGVQQNRCSLFPAVTELLTNLAVDQPAPPPNQAIGAPVGLGGVVGVGVGVVGASPNTMMPMQQLQPQVGHGPQLGPNPGGPQ
Length1535
PositionTail
OrganismDrosophila mojavensis (Fruit fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila.
Aromaticity0.07
Grand average of hydropathy-0.233
Instability index54.36
Isoelectric point8.52
Molecular weight170295.10
Publications
PubMed=17994087

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP25171
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     247.72|      35|      39|    1034|    1068|       1
---------------------------------------------------------------------------
  688-  712 (29.84/ 8.70)	......PKP.....gtH....QAPGATGEQKP.AP....APSTSS
 1003- 1024 (31.53/ 9.64)	PLSPMGLED.......NFGGPNSV..AGV..............SA
 1025- 1059 (58.82/24.79)	GGS..SPFL.....saGMRGPQSPRDSGLRFP.APHT..PPSSSN
 1060- 1100 (54.75/22.53)	PHTPASPHP..ssgggGASGGQSHANFNLTSPpAPHM..PHPSPG
 1114- 1144 (26.78/ 7.00)	PHMVHSPGPntlymqsHQDSP..............FTamSPANNN
 1146- 1171 (46.00/17.68)	PGSPSMPRP.......SPRPGQSPE..........HK..STGGGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     196.93|      66|     118|     173|     244|       2
---------------------------------------------------------------------------
  173-  243 (103.01/92.68)	QTLLRLNQVIQHRLVTGKLLPQMRDFrirngRVTFEVKHEF..SVALTVM.GDSPTVPW.RLLDIDILVEDKETG
  247-  316 (93.92/66.71)	SLVHPLQVTYIHQLIQARLVENPNAL.....SEVYNCLHYFcqSLQLEVLyTQTLRLNYeRLDDNNINVEEYVPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.57|      14|     479|     412|     426|       3
---------------------------------------------------------------------------
  412-  426 (24.04/16.36)	GTPAIlTVPVLSPCL
  913-  926 (28.53/15.50)	GVPRP.QVPVLSFCM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.33|      13|     479|     815|     827|       4
---------------------------------------------------------------------------
  815-  827 (22.83/16.35)	RLSLGDMLVVKSY
 1299- 1311 (23.50/17.07)	QLSPDDLLVIEQY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     186.26|      58|     479|     713|     775|       5
---------------------------------------------------------------------------
  554-  614 (86.71/62.15)	AFQKDENDVIDESAKQLVSIVAQppSEIPKFYTKLIRLIEFdTFVATHGPGTEVDEVSPHK
  713-  770 (99.54/86.21)	ALPKIEPHVWEDLMRRVLSISVR..SQTNKNSQVRIWVVEF.VFYSTPLQSTHQKELGSRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     174.77|      51|     903|     459|     526|       7
---------------------------------------------------------------------------
  475-  526 (89.52/82.26)	ELRYWITHRRCEKTLQHLPATATETLPfLAPPEQELLQPGRHKIYVKLH..RHP
 1350- 1402 (85.26/45.57)	ELKPELGGDQLKWTVQMCLRMSPSALP.IVPIGSACVVLGRMKILFFLHitRIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.71|      18|     361|     872|     889|       9
---------------------------------------------------------------------------
  872-  889 (31.92/20.77)	MREQLAQHLNQQHSLTSI
 1236- 1253 (30.79/19.77)	MRRQLHRNIQSEESLTAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.93|      25|      27|     113|     139|      10
---------------------------------------------------------------------------
  113-  139 (39.22/37.72)	VETADMLARMsrETLVRARL..PNFHIPA
  143-  169 (40.70/30.93)	VLTTGTYNRL..PTCIRERIvpPDAITPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      95.10|      27|     324|    1173|    1199|      12
---------------------------------------------------------------------------
 1173- 1199 (50.55/28.17)	GVGVG..GADRSGSRGTLN.RPWAGAVPTL
 1498- 1527 (44.55/23.87)	GVGVGvvGASPNTMMPMQQlQPQVGHGPQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.88|      21|      27|      27|      47|      15
---------------------------------------------------------------------------
   27-   47 (38.29/26.39)	PRINTMSMSVLIDFIIQRTYH
   57-   77 (37.60/25.79)	PRKTDMERKVEIYAYAARTRH
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25171 with Med14 domain of Kingdom Metazoa
Unable to open file!