<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25167
| Description |
"Uncharacterized protein, isoform A" |
| Sequence | MSTGPRTTILPQSKEALLKSYNARLKEDVRSMLENFEEILKLARRESHIQISKITQCEQDALEMQVRAANMVRAGESLMKLVADLKQYLILNDFHSVNEAITNNSQLFRTTQIECDKKLMKLRDEMAMDLYDLEEEYYTSIFK |
| Length | 143 |
| Position | Head |
| Organism | Drosophila mojavensis (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.473 |
| Instability index | 47.49 |
| Isoelectric point | 5.50 |
| Molecular weight | 16699.06 |
| Publications | PubMed=17994087
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25167
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.34| 18| 38| 25| 42| 1
---------------------------------------------------------------------------
25- 42 (29.49/20.74) LKEDVR..SMLENFEEILKL
62- 81 (25.85/17.41) LEMQVRaaNMVRAGESLMKL
---------------------------------------------------------------------------
|