<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25163

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMMNNYGNIMMDSPRSSPHGGRSPVVARQDSSGTLKTTISLGKTPTIIHTGPFYSMKEPPAKAELTGDKDLMTEYGLHHTLTKFKEKKFKESLASFLPNIPGINDLITHPVENSTLRSVIEKPPIGGKELLPLTPVQLAGFRLHPGPLPEQYRTTYATPARKHKNKHKKHKHKDGITTGGPESTLLDSAGLETYEKKHKKQKRHEDDKERKKRKKEKKRKKKNQSPEPGGALGIGMPSGGGGGAAPAGMGGPVMGATAIMSNPMSSSGVGMGVGVGMNAGMGANSFSSSLQMQQQLSMQHQQQQQQMPSGALMGSVLSSGGNGPGGNAGNAGGGPGSLLMSQF
Length342
PositionHead
OrganismDrosophila mojavensis (Fruit fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila.
Aromaticity0.04
Grand average of hydropathy-0.721
Instability index61.16
Isoelectric point9.95
Molecular weight36235.05
Publications
PubMed=17994087

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000256	RuleBase:RU364151
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP25163
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     119.56|      26|      32|     232|     263|       1
---------------------------------------------------------------------------
  232-  250 (34.98/ 9.71)	..........GIGMPSGGGGGAAPAGMGG
  257-  282 (39.91/18.48)	AIMSNPMsssGVGM..GVGVGM.NAGMGA
  310-  333 (44.66/12.52)	ALMGSVL...SSG.GNGPGGNAGNAG.GG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      92.69|      30|      33|      40|      72|       2
---------------------------------------------------------------------------
   40-   72 (47.63/36.39)	LGKTPTIIHTGPFysmKEPPAK..AELTGDKDLMT
   76-  107 (45.06/25.98)	LHHTLTKFKEKKF...KESLASflPNIPGINDLIT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      60.96|      12|      33|     162|     173|       3
---------------------------------------------------------------------------
  162-  173 (23.67/13.51)	HKNKHKKHK.HKD
  193-  205 (18.23/ 8.98)	YEKKHKKQKrHED
  211-  222 (19.06/ 9.67)	KRKKEKKRK.KKN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.01|      14|      22|     109|     124|       4
---------------------------------------------------------------------------
  109-  124 (19.83/15.72)	PVENSTLRsvIEKPPI
  134-  147 (26.18/14.46)	PVQLAGFR..LHPGPL
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP25163 with Med19 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) NYGNIMMDSPRSSPHGGRSPVVARQDSSGTLKTTISL
2) VENSTLRSVIEKPPIGGKELLPLTPVQLAGFRLHPGPLPEQYRTTYATPARKHKNKHKKHKHKDGITTGGPESTLLDSAGLETYEKKHKKQKRHEDDKERKKRKKEKKRKKKNQSPEPGGALGIGMPSGGGGGAAPAGMGGPVMGATAIMSNPMSSSGVGMGVGVGMNAGMGANSFSSSLQMQQQLSMQHQQQQQQMPSGALMGSVLSSGGNGPGGNAGNAGGGPGSLLM
4
110
40
339

Molecular Recognition Features

MoRF SequenceStartStop
NANANA