<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25155

Description Uncharacterized protein
SequenceMSSNTNGNGELKKLSEESLLQPPEKVFDIMYKLGEGSYGSVYKALHKESSSIVAIKLVPVESDLHEIIKEISIMQQCDSPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEEEIATILSDTLKGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKNPDERATATELLEHEFIRNAKHRSILKTMLEETCAIREQQRAHRAAGGAMSQAKSLATQEGGLMLHEEENEYNSGTVKTFVDPGTLVPEKFNEYQENSASDATMIAHREDVDDATLGPGGIKAGMAKAAAKASATAAGGAGGTGGSADVATVDSGTMVELESNLGTMVINSDSDDSSTAKRNDDQKPRYRYRPQFLDHFERKNAGPDEKATTEYSPAAVEQQLQQQQQQQQQQQQQQPQEHLASGAHDANNWEHNMEMQFQQISAINQYGLQQHQQQQQQQQQQQQLLMAYPLMTEQLIALNNQQNLLRSSQQQQGGAAAAAAVAPAAPPPAYQHQHLHTQSHAYVEGEFEFLKFLTYDDLNQRLSNIDHEMELEIEQLNKKYNAKRQPIVDAMNAKRKRQQNINNNLIKI
Length672
PositionKinase
OrganismDrosophila mojavensis (Fruit fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila.
Aromaticity0.07
Grand average of hydropathy-0.627
Instability index51.90
Isoelectric point5.44
Molecular weight75311.70
Publications
PubMed=17994087

Function

Annotated function 
GO - Cellular Component
apicomedial cortex	GO:0106037	IEA:EnsemblMetazoa
cell-cell junction	GO:0005911	IEA:EnsemblMetazoa
cytosol	GO:0005829	IEA:EnsemblMetazoa
membrane	GO:0016020	IEA:EnsemblMetazoa

GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein homodimerization activity	GO:0042803	IEA:EnsemblMetazoa
protein serine kinase activity	GO:0106310	IEA:UniProtKB-EC
protein threonine kinase activity	GO:0106311	IEA:UniProtKB-EC

GO - Biological Process
activation of cysteine-type endopeptidase activity	GO:0097202	IEA:EnsemblMetazoa
border follicle cell migration	GO:0007298	IEA:EnsemblMetazoa
hippo signaling	GO:0035329	IEA:EnsemblMetazoa
intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	GO:0042771	IEA:EnsemblMetazoa
morphogenesis of an epithelial sheet	GO:0002011	IEA:EnsemblMetazoa
negative regulation of canonical Wnt signaling pathway	GO:0090090	IEA:EnsemblMetazoa
negative regulation of glial cell proliferation	GO:0060253	IEA:EnsemblMetazoa
negative regulation of neuroblast proliferation	GO:0007406	IEA:EnsemblMetazoa
negative regulation of neuron apoptotic process	GO:0043524	IEA:EnsemblMetazoa
negative regulation of ubiquitin-dependent protein catabolic process	GO:2000059	IEA:EnsemblMetazoa
organ growth	GO:0035265	IEA:EnsemblMetazoa
peptidyl-threonine phosphorylation	GO:0018107	IEA:EnsemblMetazoa
positive regulation of apoptotic process	GO:0043065	IEA:EnsemblMetazoa
protein autophosphorylation	GO:0046777	IEA:EnsemblMetazoa
R8 cell fate specification	GO:0045464	IEA:EnsemblMetazoa
regulation of apoptotic signaling pathway	GO:2001233	IEA:EnsemblMetazoa
regulation of protein processing	GO:0070613	IEA:EnsemblMetazoa
response to ionizing radiation	GO:0010212	IEA:EnsemblMetazoa
retinal cell programmed cell death	GO:0046666	IEA:EnsemblMetazoa
stem cell proliferation	GO:0072089	IEA:EnsemblMetazoa









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP25155
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      93.23|      30|      46|     453|     498|       1
---------------------------------------------------------------------------
  441-  476 (34.51/23.20)	KRNDDQKPRYRYRpQflDHFerkNAGPDEKATTEYS
  487-  516 (58.71/36.66)	QQQQQQQQQQQQP.Q..EHL...ASGAHDANNWEHN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      69.61|      17|      76|     307|     323|       2
---------------------------------------------------------------------------
  307-  323 (29.75/19.22)	AGGAMSQAKS..LATQEGG
  343-  357 (17.31/ 7.98)	DPGTLVPEKF..NEYQE..
  398-  416 (22.55/12.72)	AGGAGGTGGSadVATVDSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.53|      22|      34|     519|     540|       3
---------------------------------------------------------------------------
  519-  540 (42.93/23.51)	MQF....QQISAI.NQYGLQQHQQQQQ
  550-  576 (28.61/13.42)	MAYplmtEQLIALnNQQNLLRSSQQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.86|      15|      17|     212|     228|       4
---------------------------------------------------------------------------
  212-  228 (25.55/18.59)	LEMAEGKPP..YGEihPMR
  230-  246 (26.32/12.72)	IFMIPQKPPpsFRE..PDR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.98|      15|      17|     266|     280|       5
---------------------------------------------------------------------------
  259-  276 (17.72/10.85)	LVKNpdeRATATELLEHE
  277-  294 (19.26/12.41)	FIRNakhRSILKTMLEET
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.31|      22|      23|     111|     133|       7
---------------------------------------------------------------------------
  111-  133 (31.33/29.10)	MRLRKKTLTEEEIATILSDTlKG
  137-  158 (36.98/28.83)	LHLRRKIHRDIKAANILLNT.EG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25155 with Med12 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) IREQQRAHRAAGGAMSQAKSLATQEGGLMLHEEENEYNSGTVKT
2) QQNLLRSSQQQQGGAAAAAAVAPAAPPPAYQHQHLHT
3) TLVPEKFNEYQENSASDATMIAHREDVDDATLGPGGIKAGMAKAAAKASATAAGGAGGTGGSADVATVDSGTMVELESNLGTMVINSDSDDSSTAKRNDDQKPRYRYRPQFLDHFERKNAGPDEKATTEYSPAAVEQQLQQQQQQQQQQQQQQPQEHLASGAHDANNWEHNMEMQ
297
565
346
340
601
520










Molecular Recognition Features






MoRF SequenceStartStop




NANANA