Description | Uncharacterized protein |
Sequence | MSTPNNENGSGNLMDEFEEAFQSCLLSLTKQEPNSGTNKEEIELEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPYMLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHTRPGPAMMPGPCPGGMPPLGGPGPRPGLMSGMPSGQMPGSQQHLLQAQQMQMRMMGKLPPK |
Length | 181 |
Position | Head |
Organism | Drosophila mojavensis (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.667 |
Instability index | 69.37 |
Isoelectric point | 6.31 |
Molecular weight | 20300.22 |
Publications | PubMed=17994087 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblMetazoa |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:EnsemblMetazoa |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa |
Binary Interactions |
Repeats | >MDP25146 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 56.50| 13| 15| 124| 137| 1 --------------------------------------------------------------------------- 124- 137 (27.27/14.52) GPAMMPGpCPGGMP 141- 153 (29.22/11.49) GPGPRPG.LMSGMP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.19| 22| 22| 1| 22| 2 --------------------------------------------------------------------------- 1- 22 (39.40/25.25) MSTPNNENGSGNLMDEFEEAFQ 26- 47 (35.79/22.33) LSLTKQEPNSGTNKEEIELEVQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 60.62| 18| 22| 75| 93| 3 --------------------------------------------------------------------------- 75- 93 (27.01/20.10) KPYMLIKDENQDLSiEIQR 100- 117 (33.61/20.54) KHYNRLEEWKACLS.DIQQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KLPPK 2) LMDEFEEA | 177 13 | 181 20 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab