| Description | Uncharacterized protein |
| Sequence | MSTPNNENGSGNLMDEFEEAFQSCLLSLTKQEPNSGTNKEEIELEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPYMLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHTRPGPAMMPGPCPGGMPPLGGPGPRPGLMSGMPSGQMPGSQQHLLQAQQMQMRMMGKLPPK |
| Length | 181 |
| Position | Head |
| Organism | Drosophila mojavensis (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.667 |
| Instability index | 69.37 |
| Isoelectric point | 6.31 |
| Molecular weight | 20300.22 |
| Publications | PubMed=17994087 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblMetazoa |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:EnsemblMetazoa |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa |
| Binary Interactions |
| Repeats |
>MDP25146
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.50| 13| 15| 124| 137| 1
---------------------------------------------------------------------------
124- 137 (27.27/14.52) GPAMMPGpCPGGMP
141- 153 (29.22/11.49) GPGPRPG.LMSGMP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.19| 22| 22| 1| 22| 2
---------------------------------------------------------------------------
1- 22 (39.40/25.25) MSTPNNENGSGNLMDEFEEAFQ
26- 47 (35.79/22.33) LSLTKQEPNSGTNKEEIELEVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.62| 18| 22| 75| 93| 3
---------------------------------------------------------------------------
75- 93 (27.01/20.10) KPYMLIKDENQDLSiEIQR
100- 117 (33.61/20.54) KHYNRLEEWKACLS.DIQQ
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) KLPPK 2) LMDEFEEA | 177 13 | 181 20 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab