<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25145
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAKMYGKGKTAIESEDQQKRRWQIELEFVQCLSNPNYLNFLAQRGYFKDPCFINYLKYLQYWKEPEYAKYLMYPMCLYFLDLLQYEHFRREIVNNQCCKFIDDQAILQWQHYTRKRIKLINSVQENAAAVAAATQQQQQLQQQQQQPQTNGGILAPSEAASVAAAEAANPLQQATLQNGSSSASQSQQQPLTAREPAPTQTP |
Length | 202 |
Position | Middle |
Organism | Drosophila mojavensis (Fruit fly) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.674 |
Instability index | 68.04 |
Isoelectric point | 8.21 |
Molecular weight | 23295.05 |
Publications | PubMed=17994087
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblMetazoa
|
GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblMetazoa
|
GO - Biological Process | anterior/posterior axis specification, embryo GO:0008595 IEA:EnsemblMetazoa
regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
Repeats |
>MDP25145
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.19| 23| 29| 127| 155| 1
---------------------------------------------------------------------------
127- 149 (43.28/26.16) AAAVAAA....TQQQQQLQ.......QQQQQPQT
159- 192 (29.90/ 7.43) AASVAAAeaanPLQQATLQngsssasQSQQQPLT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.79| 23| 29| 30| 58| 2
---------------------------------------------------------------------------
30- 58 (36.81/35.25) QCLSNPNYLNFLAqrgYfkdP.C..FINYLKY
60- 85 (38.98/21.19) QYWKEPEYAKYLM...Y...PmClyFLDLLQY
---------------------------------------------------------------------------
|