| Description | Uncharacterized protein |
| Sequence | MADRLTQLQDTVNQQAEHFCNAIGVIQQTSYPSKFANFDRTGSQTPVQNPPQEDYAQLFAQLIARCAKDIDTLIESLPNEDSSIELQNSSLKRLEIENQETAEQLEQVVQKGELLLEKIQSALGDIAQSQLDMQITLKPNLK |
| Length | 142 |
| Position | Middle |
| Organism | Drosophila mojavensis (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.542 |
| Instability index | 51.44 |
| Isoelectric point | 4.42 |
| Molecular weight | 15944.65 |
| Publications | PubMed=17994087 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP25139 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) DYAQL 2) SLKRLEIE | 54 90 | 58 97 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab