<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25121

Description GH19375
SequenceMSTPNNEAGGGNLMDEFEEAFQACLLSLTKQEPNSGTNKEEIDLEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPHMLIKDENQDLSIEIARKETLLQKHYNRLEEWKACLSDIQQGVHNRPTHPMMPGPCPTGMQPMGGPGPRPGLMSGMPPGVQLPGGPQHLLQAQQVQQLRMMGKLPPK
Length183
PositionHead
OrganismDrosophila grimshawi (Hawaiian fruit fly) (Idiomyia grimshawi)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila> Hawaiian Drosophila.
Aromaticity0.04
Grand average of hydropathy-0.631
Instability index60.82
Isoelectric point6.52
Molecular weight20468.42
Publications
PubMed=17994087

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblMetazoa

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:EnsemblMetazoa

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:EnsemblMetazoa









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP25121
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.13|      15|      18|     127|     142|       1
---------------------------------------------------------------------------
  127-  142 (30.76/16.47)	MMPGPcPTGMQPMGGP
  148-  162 (32.37/13.01)	LMSGM.PPGVQLPGGP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25121 with Med28 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) SDIQQGVHNRPTHPMMPGPCPTGMQPMGGPGPRPGLMSGMPPGVQLPGGPQHLLQAQQVQQLRMMGKLPPK
113
183










Molecular Recognition Features






MoRF SequenceStartStop




NANANA