<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25120
| Description |
GH19239 |
| Sequence | MAGNFWQSSHSQQWILDKQDLLRERQNDLLALSEDEYQKIFIFFANVIQVLGEQLKLRQQVIATATVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEFGVISNSRLISICQSAIKTKFSYAYTQEFPYRTNHILECEFYLLENLDCCLIVFQPYRPLLQLVQDMGQEDQLLTLSWRIVNDSLRTDVCLLYPPYQIAIACLQIACVILQKDATKQWFAELNVDLDKVQEIVRAIVNLYELWKDWKEKDEIQMLLAKIPKPKPPPQR |
| Length | 267 |
| Position | Kinase |
| Organism | Drosophila grimshawi (Hawaiian fruit fly) (Idiomyia grimshawi) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Hawaiian Drosophila.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.070 |
| Instability index | 51.00 |
| Isoelectric point | 5.83 |
| Molecular weight | 31285.07 |
| Publications | PubMed=17994087
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblMetazoa
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:EnsemblMetazoa
transcription coregulator activity GO:0003712 IEA:EnsemblMetazoa
|
| GO - Biological Process | chaeta development GO:0022416 IEA:EnsemblMetazoa
imaginal disc-derived leg segmentation GO:0036011 IEA:EnsemblMetazoa
positive regulation of autophagy GO:0010508 IEA:EnsemblMetazoa
regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa
sex comb development GO:0045498 IEA:EnsemblMetazoa
snRNA 3'-end processing GO:0034472 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
| Repeats |
>MDP25120
No repeats found
|