<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25109
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MNPLDKIHALDEIEKDIILCMQSAGQALQELGKEKSSQKSAETQSQQFLKSLSSVESKLSEQINYLTQVSTGQPHEGSGYASAKVLQMAWHRIQHARSRVRELEETKAKHSHAARQQQKRQQEHAAAQQQQQAAAAAAAQQHQQHASGGGVAGAGAADGGTAGISNSAGGAVSADAGGGLPTN |
| Length | 183 |
| Position | Head |
| Organism | Drosophila grimshawi (Hawaiian fruit fly) (Idiomyia grimshawi) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Hawaiian Drosophila.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.705 |
| Instability index | 53.39 |
| Isoelectric point | 7.14 |
| Molecular weight | 19195.87 |
| Publications | PubMed=17994087
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblMetazoa
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:EnsemblMetazoa
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
| Repeats |
>MDP25109
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.34| 16| 16| 22| 37| 1
---------------------------------------------------------------------------
22- 37 (26.11/15.38) QSAGQALQELGKEKSS
39- 54 (24.22/13.77) KSAETQSQQFLKSLSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.61| 18| 18| 108| 125| 2
---------------------------------------------------------------------------
108- 125 (31.18/14.23) AKHSH..AARQQQKRQQEHA
127- 146 (23.43/ 8.94) AQQQQqaAAAAAAQQHQQHA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.86| 10| 19| 148| 160| 3
---------------------------------------------------------------------------
148- 160 (16.37/13.94) GGGV.AGAGaadGG
169- 179 (16.49/ 6.15) GGAVsADAG...GG
---------------------------------------------------------------------------
|